PDB entry 1fyk

View 1fyk on RCSB PDB site
Description: serendipitous crystal structure containing the heat shock transcription factor's DNA binding domain and cognate DNA that is translationally disordered
Class: transcription/DNA
Keywords: crystal-packing interface, crystallization, protein-DNA interface, protein-protein interface, static disorder, TRANSCRIPTION/DNA COMPLEX
Deposited on 2000-10-02, released 2001-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: heat shock factor protein
  Species: KLUYVEROMYCES LACTIS [TaxId:28985]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P22121 (0-91)
    • modified residue (11)
    • modified residue (61)
    • engineered (89-91)
  Domains in SCOPe 2.08: d1fyka_
• Chain 'C':
  Compound: hse DNA-phosphate backbone
  Species: synthetic, synthetic
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1fykA (A:)
  arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
  nmygwhkvqdvksgsmlsnndsrwefenerha
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1fykA (A:)
  arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
  nmygwhkvqdvksgnndsrwefenerha
  

  
  
• Chain 'C':
  No sequence available.