PDB entry 1fye

View 1fye on RCSB PDB site
Description: Aspartyl Dipeptidase (Anisotropic B-Factor Refinement)
Class: hydrolase
Keywords: serine protease, peptidase, catalytic triad, strand-helix motif, HYDROLASE
Deposited on 2000-09-29, released 2001-01-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.157
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aspartyl dipeptidase
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fyea_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fyeA (A:)
    mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl
    gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws
    aganlacptirttndmpivdpngfdaldlfplqinphftnalpeghkgetreqrirellv
    vapeltviglpegnwiqvsngqavlggpnttwvfkageeavaleaghrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fyeA (A:)
    mellllsnstlpgkawlehalplianqlngrrsavfipfagvtqtwdeytdktaevlapl
    gvnvtgihrvadplaaiekaeiiivgggntfqllkesrergllapmadrvkrgalyigws
    aganlacptirttndmpivdpngfdaldlfplqinphftntreqrirellvvapeltvig
    lpegnwiqvsngqavlggpnttwvfkageeavaleaghrf