PDB entry 1fyb

View 1fyb on RCSB PDB site
Description: solution structure of c1-t1, a two-domain proteinase inhibitor derived from the circular precursor protein na-propi from nicotiana alata
Class: Hydrolase Inhibitor
Keywords: two-domain protein, Hydrolase Inhibitor
Deposited on 2000-09-28, released 2001-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -1.98 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: proteinase inhibitor
  Species: Nicotiana alata [TaxId:4087]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q40378 (0-110)
  Domains in SCOPe 2.08: d1fyba1, d1fyba2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fybA (A:)
  drictnccagtkgckyfsddgtfvcegesdprnpkactlncdpriaygvcprseekkndr
  ictnccagtkgckyfsddgtfvcegesdprnpkacprncdpriaygicpla