PDB entry 1fy5

View 1fy5 on RCSB PDB site
Description: Fusarium oxysporum trypsin at atomic resolution
Class: hydrolase
Keywords: beta barrel, HYDROLASE
Deposited on 2000-09-28, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 0.81 Å
R-factor: 0.124
AEROSPACI score: 1.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin
    Species: FUSARIUM OXYSPORUM [TaxId:5507]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fy5a_
  • Chain 'B':
    Compound: gly-ala-lys
    Database cross-references and differences (RAF-indexed):
    • PDB 1FY5 (0-2)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fy5A (A:)
    ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
    tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
    agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
    ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
    

  • Chain 'B':
    No sequence available.