PDB entry 1fy1

View 1fy1 on RCSB PDB site
Description: [r23s,f25e]hbp, a mutant of human heparin binding protein (cap37)
Class: antimicrobial protein
Keywords: Serine protease homolog, Endotoxin (lipid A) binding site, ANTIMICROBIAL PROTEIN
Deposited on 2000-09-28, released 2001-09-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparin-binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P20160 (0-224)
      • engineered (22)
      • engineered (24)
    Domains in SCOPe 2.08: d1fy1a_
  • Heterogens: NAG, EOH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fy1A (A:)
ivggrkarprqfpflasiqnqgshecggaliharfvmtaascfqsqnpgvstvvlgaydl
rrrerqsrqtfsissmsengydpqqnlndlmllqldreanltssvtilplplqnatveag
trcqvagwgsqrsggrlsrfprfvnvtvtpedqcrpnnvctgvltrrggicngdggtplv
ceglahgvasfslgpcgrgpdfftrvalfrdwidgvlnnpgpgpa