PDB entry 1fxz

View 1fxz on RCSB PDB site
Description: crystal structure of soybean proglycinin a1ab1b homotrimer
Deposited on 2000-09-28, released 2001-09-28
The last revision prior to the SCOP 1.71 freeze date was dated 2001-09-28, with a file datestamp of 2001-09-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.199
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fxzA (A:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxzA (A:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
    dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
    ekgaivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrls
    aefgslrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnf
    vvaarsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnn
    pfkflvppqes
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fxzB (B:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxzB (B:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
    dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
    ekgaivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrls
    aefgslrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnf
    vvaarsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnn
    pfkflvppqes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fxzC (C:)
    fssreqpqqnecqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnal
    rrpsytngpqeiyiqqgkgifgmiypgcpstfeepqqpqqrgqssrpqdrhqkiynfreg
    dliavptgvawwmynnedtpvvavsiidtnslenqldqmprrfylagnqeqeflkyqqeq
    gghqsqkgkhqqeeeneggsilsgftleflehafsvdkqiaknlqgenegedkgaivtvk
    gglsvikpptdeqqqrpqeeeeeeedekpqckgkdkhcqrprgsqsksrrngidetictm
    rlrhnigqtsspdiynpqagsvttatsldfpalswlrlsaefgslrknamfvphynlnan
    siiyalngraliqvvncngervfdgelqegrvlivpqnfvvaarsqsdnfeyvsfktndt
    pmigtlagansllnalpeeviqhtfnlksqqarqiknnnpfkflvppqesqkrava
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxzC (C:)
    necqiqklnalkpdnriesegglietwnpnnkpfqcagvalsrctlnrnalrrpsytngp
    qeiyiqqgkgifgmiypgcpstrhqkiynfregdliavptgvawwmynnedtpvvavsii
    dtnslenqldqmprrfylagnqeqeflkyqqggsilsgftleflehafsvdkqiaknlqg
    ekgaivtvkgglsvikpictmrlrhnigqtsspdiynpqagsvttatsldfpalswlrls
    aefgslrknamfvphynlnansiiyalngraliqvvncngervfdgelqegrvlivpqnf
    vvaarsqsdnfeyvsfktndtpmigtlagansllnalpeeviqhtfnlksqqarqiknnn
    pfkflvppqes