PDB entry 1fxy

View 1fxy on RCSB PDB site
Description: coagulation factor xa-trypsin chimera inhibited with d-phe-pro-arg-chloromethylketone
Class: hydrolase/hydrolase inhibitor
Keywords: chimera, protease, chloromethylketone, hydrolase-hydrolase inhibitor complex
Deposited on 1998-04-22, released 1998-06-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.18
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coagulation factor xa-trypsin chimera
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fxya_
  • Heterogens: 0G6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxyA (A:)
    ivggynckdgevpwqallineenegfcggtilsefyiltaahclyqakrfkvrvgdrnte
    qeeggeavhevevvikhnrftketydfdiavlrlktpitfrmnvapaslptappatgtkc
    lisgwgntassgadypdelqcldapvlsqakceasypgkitsnmfcvgfleggkdscqgd
    sggpvvcngqlqgvvswgdgcaqknkpgvytkvynyvkwikntiaans