PDB entry 1fxw

View 1fxw on RCSB PDB site
Description: crystal structure of the recombinant alpha1/alpha2 catalytic heterodimer of bovine brain platelet-activating factor acetylhydrolase ib.
Class: hydrolase
Keywords: alpha beta hydrolase fold
Deposited on 2000-09-27, released 2001-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.212
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: platelet-activating factor acetylhydrolase ib gamma subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fxwa_
  • Chain 'F':
    Compound: platelet-activating factor acetylhydrolase ib beta subunit
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fxwf_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fxwA (A:)
    msgdenpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwre
    lfsplhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikai
    vqlvnerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvh
    sdgtishhdmydylhlsrlgytpvcralhslllrlltqdqgqggaplpepsp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxwA (A:)
    enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
    lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
    nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
    ishhdmydylhlsrlgytpvcralhslllrl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1fxwF (F:)
    msqgdsnpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwr
    elfsplhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggiea
    ivqlintrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfv
    hsdgaischdmfdflhltgggyakickplhelimqlleetpeekqttia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxwF (F:)
    snpaaiphaaediqgddrwmsqhnrfvldckdkepdvlfvgdsmvqlmqqyeiwrelfsp
    lhalnfgiggdttrhvlwrlkngelenikpkvivvwvgtnnhentaeevaggieaivqli
    ntrqpqakiivlgllprgekpnplrqknakvnqllkvslpklanvqlldtdggfvhsdga
    ischdmfdflhltgggyakickplhelimqll