PDB entry 1fxu

View 1fxu on RCSB PDB site
Description: purine nucleoside phosphorylase from calf spleen in complex with n(7)- acycloguanosine inhibitor and a phosphate ion
Deposited on 2000-09-27, released 2000-10-18
The last revision prior to the SCOP 1.67 freeze date was dated 2001-03-28, with a file datestamp of 2001-03-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.175
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1fxua_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fxuA (A:)
    mqngytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpest
    vpghagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaaggl
    npnfevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkq
    mgeqrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfsl
    itnkvimdtesqgkanheevleagkqaaqkleqfvsllmasipvsghtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxuA (A:)
    gytyedyqdtakwllshteqrpqvavicgsglgglvnkltqaqtfdyseipnfpestvpg
    hagrlvfgilngracvmmqgrfhmyegypfwkvtfpvrvfrllgvetlvvtnaagglnpn
    fevgdimlirdhinlpgfsgqnplrgpneerfgvrfpamsdaydrdmrqkahstwkqmge
    qrelqegtyvmlggpnfetvaecrllrnlgadavgmstvpevivarhcglrvfgfslitn
    kvimdtgkanheevleagkqaaqkleqfvsllmasipv