PDB entry 1fxs

View 1fxs on RCSB PDB site
Description: GDP-fucose synthetase from escherichia coli complex with nadp
Class: oxidoreductase
Keywords: epimerase-reductase, nadp, GDP-fucose, fucose synthetase, oxidoreductase
Deposited on 1998-09-01, released 1999-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.163
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (GDP-fucose synthetase)
    Species: Escherichia coli [TaxId:83333]
    Gene: WCAG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fxsa_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fxsA (A:)
    mskqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvy
    laaakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpma
    esellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshv
    ipallrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpml
    shinvgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheis
    leaglastyqwflenqdrfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxsA (A:)
    kqrvfiaghrgmvgsairrqleqrgdvelvlrtrdelnlldsravhdffaseridqvyla
    aakvggivanntypadfiyqnmmiesniihaahqndvnkllflgssciypklakqpmaes
    ellqgtleptnepyaiakiagiklcesynrqygrdyrsvmptnlygphdnfhpsnshvip
    allrrfheataqnapdvvvwgsgtpmreflhvddmaaasihvmelahevwlentqpmlsh
    invgtgvdctirelaqtiakvvgykgrvvfdaskpdgtprklldvtrlhqlgwyheisle
    aglastyqwflenqdrf