PDB entry 1fxr

View 1fxr on RCSB PDB site
Description: crystal structure of the ferredoxin I from desulfovibrio africanus at 2.3 angstroms resolution
Class: electron transport
Keywords: electron transport
Deposited on 1994-11-14, released 1995-01-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fxra_
  • Chain 'B':
    Compound: ferredoxin I
    Species: DESULFOVIBRIO AFRICANUS [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1fxrb_
  • Heterogens: SO4, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxrA (A:)
    arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
    wede
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxrB (B:)
    arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
    wede