PDB entry 1fxr

View 1fxr on RCSB PDB site
Description: crystal structure of the ferredoxin i from desulfovibrio africanus at 2.3 angstroms resolution
Deposited on 1994-11-14, released 1995-01-26
The last revision prior to the SCOP 1.63 freeze date was dated 1995-01-26, with a file datestamp of 1995-02-03.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.182
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1fxra_
  • Chain 'B':
    Domains in SCOP 1.63: d1fxrb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fxrA (A:)
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fxrB (B:)
arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
wede