PDB entry 1fxn

View 1fxn on RCSB PDB site
Description: the structure of the oxidized form of clostridial flavodoxin at 1.9 angstroms resolution
Deposited on 1974-11-01, released 1974-11-01
The last revision was dated 1974-11-01, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: FMN

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence, based on SEQRES records:
    >1fxn_ (-)
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermngygcvvvetplivqne
pdeaeqdciefgkkiani

    Sequence, based on observed residues (ATOM records):
    >1fxn_ (-)
mkivywsgtgntekmaeliakgiiesgkdvntinvsdvnidellnedililgcsamgdev
leesefepfieeistkisgkkvalfgsygwgdgkwmrdfeermdgygcvvvetplivqne
pdeaeqdciefgkkiani

  • Chain 'p':
    No sequence available.