PDB entry 1fxj

View 1fxj on RCSB PDB site
Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase
Class: transferase
Keywords: acetyltransferase, bifunctional, crystallography, drug design, pyrophosphorylase
Deposited on 2000-09-26, released 2000-10-18
The last revision prior to the SCOP 1.75 freeze date was dated 2000-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.234
AEROSPACI score: -1.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fxja1, d1fxja2
  • Chain 'B':
    Compound: udp-n-acetylglucosamine pyrophosphorylase
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fxjb1, d1fxjb2
  • Heterogens: SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fxjA (A:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxjA (A:)
    nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
    kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
    qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
    wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
    qaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsv
    igddceispytvvedanlaaactigpf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fxjB (B:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fxjB (B:)
    nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
    kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
    qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
    wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
    qaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsv
    igddceispytvvedanlaaacti