PDB entry 1fxi

View 1fxi on RCSB PDB site
Description: structure of the [2fe-2s] ferredoxin I from the blue-green alga aphanothece sacrum at 2.2 angstroms resolution
Class: electron transfer (iron-sulfur protein)
Keywords: electron transfer (iron-sulfur protein)
Deposited on 1990-08-28, released 1991-10-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.23
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fxia_
  • Chain 'B':
    Compound: ferredoxin I
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fxib_
  • Chain 'C':
    Compound: ferredoxin I
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fxic_
  • Chain 'D':
    Compound: ferredoxin I
    Species: Aphanothece sacrum [TaxId:1122]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fxid_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fxiA (A:)
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fxiB (B:)
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fxiC (C:)
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fxiD (D:)
asykvtlktpdgdnvitvpddeyildvaeeegldlpyscragacstcagklvsgpapded
qsfldddqiqagyiltcvayptgdcviethkeealy