PDB entry 1fxf

View 1fxf on RCSB PDB site
Description: carboxylic ester hydrolase complex (dimeric pla2 + mj33 inhibitor + phosphate ions)
Class: hydrolase
Keywords: hydrolase, enzyme, carboxylic ester hydrolase, dimer, phosphate binding, inhibitor binding
Deposited on 2000-09-25, released 2001-09-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.161
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fxfa_
  • Chain 'B':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fxfb_
  • Heterogens: CA, PO4, MJI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxfA (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxfB (B:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc