PDB entry 1fxd

View 1fxd on RCSB PDB site
Description: refined crystal structure of ferredoxin II from desulfovibrio gigas at 1.7 angstroms
Class: electron transfer(iron-sulfur)
Keywords: electron transfer(iron-sulfur)
Deposited on 1991-04-08, released 1993-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin II
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00209 (0-57)
      • conflict (10)
    Domains in SCOPe 2.08: d1fxda_
  • Heterogens: F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fxdA (A:)
    pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs