PDB entry 1fxd

View 1fxd on RCSB PDB site
Description: refined crystal structure of ferredoxin II from desulfovibrio gigas at 1.7 angstroms
Class: electron transfer(iron-sulfur)
Keywords: electron transfer(iron-sulfur)
Deposited on 1991-04-08, released 1993-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: ferredoxin II
  Species: Desulfovibrio gigas [TaxId:879]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00209 (0-57)
    • conflict (10)
  Domains in SCOPe 2.08: d1fxda_
• Heterogens: F3S, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fxdA (A:)
  pievnddcmaceacveicpdvfemneegdkavvinpdsdldcveeaidscpaeaivrs