PDB entry 1fxa
View 1fxa on RCSB PDB site
Description: crystallization and structure determination to 2.5-angstroms resolution of the oxidized [2fe-2s] ferredoxin isolated from anabaena 7120
Class: electron transport
Keywords: electron transport
Deposited on
1991-01-09, released
1992-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.34
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: [2Fe-2S] ferredoxin
Species: Nostoc sp. [TaxId:103690]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1fxaa_ - Chain 'B':
Compound: [2Fe-2S] ferredoxin
Species: Nostoc sp. [TaxId:103690]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.05: d1fxab_ - Heterogens: FES, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1fxaA (A:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1fxaB (B:)
atfkvtlineaegtkheievpddeyildaaeeqgydlpfscragacstcagklvsgtvdq
sdqsfldddqieagyvltcvayptsdvviqthkeedly