PDB entry 1fx9

View 1fx9 on RCSB PDB site
Description: carboxylic ester hydrolase complex (dimeric pla2 + mj33 inhibitor + sulphate ions)
Class: hydrolase
Keywords: hydrolase, enzyme, carboxylic ester hydrolase, dimer, sulphate binding, inhibitor binding
Deposited on 2000-09-25, released 2001-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.171
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fx9a_
  • Chain 'B':
    Compound: phospholipase a2, major isoenzyme
    Species: Sus scrofa [TaxId:9823]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fx9b_
  • Heterogens: CA, SO4, MJI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx9A (A:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx9B (B:)
    alwqfrsmikcaipgshplmdfnnygcycglggsgtpvdeldrccethdncyrdaknlds
    ckflvdnpytesysyscsnteitcnsknnaceaficncdrnaaicfskapynkehknldt
    kkyc