PDB entry 1fx8

View 1fx8 on RCSB PDB site
Description: crystal structure of the e. coli glycerol facilitator (glpf) with substrate glycerol
Deposited on 2000-09-25, released 2000-11-01
The last revision prior to the SCOP 1.61 freeze date was dated 2000-11-01, with a file datestamp of 2000-11-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1fx8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx8A (A:)
    tlkgqciaeflgtglliffgvgcvaalkvagasfgqweisviwglgvamaiyltagvsga
    hlnpavtialwlfacfdkrkvipfivsqvagafcaaalvyglyynlffdfeqthhivrgs
    vesvdlagtfstypnphinfvqafavemvitailmglilaltddgngvprgplaplligl
    liavigasmgpltgfamnpardfgpkvfawlagwgnvaftggrdipyflvplfgpivgai
    vgafayrkligrhl