PDB entry 1fx7

View 1fx7 on RCSB PDB site
Description: crystal structure of the iron-dependent regulator (ider) from mycobacterium tuberculosis
Class: signaling protein
Keywords: IdeR, DtxR, iron-dependent regulator, Mycobacterium tuberculosis, SIGNALING PROTEIN
Deposited on 2000-09-25, released 2001-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: iron-dependent repressor ider
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A672 (0-229)
      • conflict (135)
    Domains in SCOPe 2.07: d1fx7a1, d1fx7a2, d1fx7a3
  • Chain 'B':
    Compound: iron-dependent repressor ider
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A672 (0-229)
      • conflict (135)
    Domains in SCOPe 2.07: d1fx7b1, d1fx7b2, d1fx7b3
  • Chain 'C':
    Compound: iron-dependent repressor ider
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A672 (0-229)
      • conflict (135)
    Domains in SCOPe 2.07: d1fx7c1, d1fx7c2, d1fx7c3
  • Chain 'D':
    Compound: iron-dependent repressor ider
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A672 (0-229)
      • conflict (135)
    Domains in SCOPe 2.07: d1fx7d1, d1fx7d2, d1fx7d3
  • Heterogens: SO4, CO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx7A (A:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipgldelgvgpepgaddanlvrltelpagspvavvvrqltehvqgdidl
    itrlkdagvvpnarvtvettpgggvtivipghenvtlphemahavkvekv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fx7B (B:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipgldelgvgpepgaddanlvrltelpagspvavvvrqltehvqgdidl
    itrlkdagvvpnarvtvettpgggvtivipghenvtlphemahavkvekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx7B (B:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipgldelgvlvrltelpagspvavvvrqltehvqgdidlitrlkdagvv
    pnarvtvettpgggvtivipghenvtlphemahavkvekv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fx7C (C:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipgldelgvgpepgaddanlvrltelpagspvavvvrqltehvqgdidl
    itrlkdagvvpnarvtvettpgggvtivipghenvtlphemahavkvekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx7C (C:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipgldelgvlvrltelpagspvavvvrqltehvqgdidlitrlkdagvv
    pnarvtvettpgggvtivipghenvtlphemahavkvekv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fx7D (D:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipgldelgvgpepgaddanlvrltelpagspvavvvrqltehvqgdidl
    itrlkdagvvpnarvtvettpgggvtivipghenvtlphemahavkvekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx7D (D:)
    mnelvdttemylrtiydleeegvtplrariaerldqsgptvsqtvsrmerdgllrvagdr
    hleltekgralaiavmrkhrlaerllvdviglpweevhaeacrwehvmsedverrlvkvl
    nnpttspfgnpipgldelgvlvrltelpagspvavvvrqltehvqgdidlitrlkdagvv
    pnarvtvettpgggvtivipghenvtlphemahavkvekv