PDB entry 1fx5

View 1fx5 on RCSB PDB site
Description: crystal structure analysis of ulex europaeus lectin I
Class: sugar binding protein
Keywords: Legume lectin, UE-I, homo-dimer, fucose specific lectin
Deposited on 2000-09-25, released 2001-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-H(O) lectin I
    Species: ULEX EUROPAEUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22972 (0-End)
      • conflict (22)
      • conflict (64)
      • conflict (110)
      • conflict (114)
      • conflict (135)
      • conflict (148)
      • conflict (216)
      • conflict (235-236)
    Domains in SCOP 1.73: d1fx5a_
  • Chain 'B':
    Compound: anti-H(O) lectin I
    Species: ULEX EUROPAEUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22972 (0-End)
      • conflict (22)
      • conflict (64)
      • conflict (110)
      • conflict (114)
      • conflict (135)
      • conflict (148)
      • conflict (216)
      • conflict (235-236)
    Domains in SCOP 1.73: d1fx5b_
  • Heterogens: MN, CA, MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fx5A (A:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx5A (A:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fx5B (B:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    ns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx5B (B:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfin