PDB entry 1fx5

View 1fx5 on RCSB PDB site
Description: crystal structure analysis of ulex europaeus lectin i
Deposited on 2000-09-25, released 2001-01-17
The last revision prior to the SCOP 1.55 freeze date was dated 2001-01-17, with a file datestamp of 2001-01-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fx5a_
  • Chain 'B':
    Domains in SCOP 1.55: d1fx5b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx5A (A:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fx5B (B:)
    sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
    ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
    tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
    ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfin