PDB entry 1fx4

View 1fx4 on RCSB PDB site
Description: structure analysis of adenylate cyclases from trypanosoma brucei in their monomeric state
Class: lyase
Keywords: adenylyl cyclases, catalysis, trypanosomes, monomer-dimer, magnesium, LYASE
Deposited on 2000-09-25, released 2001-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-31, with a file datestamp of 2018-01-26.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-type adenylate cyclase gresag 4.3
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99280 (0-230)
      • conflict (83)
      • conflict (94)
      • conflict (118-119)
    Domains in SCOPe 2.08: d1fx4a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fx4A (A:)
dndsapkeptgpvtliftdiesstalwaahpdlmpdavathhrlirslitryecyevktv
gdsfmiaskspfaavqlaqelqlcflrldwetnavdesyrefeeqraegeceytpptasl
dpevysrlwnglrvrvgihtglcdirydevtkgydyygrtsnmaartesvanggqvlmth
aaymslsgedrnqldvttlgatvlrgvpepvrmyqlnavpgrnfaalrldr