PDB entry 1fx3

View 1fx3 on RCSB PDB site
Description: crystal structure of h. influenzae secb
Class: transport protein
Keywords: protein trasnport, translocation, TRANSPORT PROTEIN
Deposited on 2000-09-25, released 2000-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.241
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein-export protein secb
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fx3a_
  • Chain 'B':
    Compound: protein-export protein secb
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fx3b_
  • Chain 'C':
    Compound: protein-export protein secb
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fx3c_
  • Chain 'D':
    Compound: protein-export protein secb
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1fx3d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fx3A (A:)
    mseqkqdvaateeqqpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgd
    dlyevvlnisvettledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyar
    elvsnlvnrgtfpalnlspvnfdalfveymnrqqaenaeekseeeqtkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx3A (A:)
    qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett
    ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa
    lnlspvnfdalfveymnrqqaen
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fx3B (B:)
    mseqkqdvaateeqqpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgd
    dlyevvlnisvettledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyar
    elvsnlvnrgtfpalnlspvnfdalfveymnrqqaenaeekseeeqtkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx3B (B:)
    qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett
    ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa
    lnlspvnfdalfveymnrqqaenaeekse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fx3C (C:)
    mseqkqdvaateeqqpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgd
    dlyevvlnisvettledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyar
    elvsnlvnrgtfpalnlspvnfdalfveymnrqqaenaeekseeeqtkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx3C (C:)
    qpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvett
    ledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpa
    lnlspvnfdalfveymnrqqae
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1fx3D (D:)
    mseqkqdvaateeqqpvlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgd
    dlyevvlnisvettledsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyar
    elvsnlvnrgtfpalnlspvnfdalfveymnrqqaenaeekseeeqtkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fx3D (D:)
    vlqiqriyvkdvsfeapnlphifqqewkpklgfdlstettqvgddlyevvlnisvettle
    dsgdvaficevkqagvftisgledvqmahcltsqcpnmlfpyarelvsnlvnrgtfpaln
    lspvnfdalfveymn