PDB entry 1fx2

View 1fx2 on RCSB PDB site
Description: structural analysis of adenylate cyclases from trypanosoma brucei in their monomeric state
Class: lyase
Keywords: cAMP, trypanosomes, adenylyl cyclases, monomer-dimer, catalysis
Deposited on 2000-09-25, released 2001-02-28
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.178
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: receptor-type adenylate cyclase gresag 4.1
    Species: Trypanosoma brucei
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1fx2a_
  • Heterogens: SO4, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fx2A (A:)
nnnrapkeptdpvtliftdiesstalwaahpdlmpdavaahhrmvrsligrykcyevktv
gdsfmiaskspfaavqlaqelqlcflhhdwgtnalddsyrefeeqraegeceytpptahm
dpevysrlwnglrvrvgihtglcdirhdevtkgydyygrtpnmaartesvanggqvlmth
aaymslsaedrkqidvtalgdvalrgvsdpvkmyqlntvpsrnfaalrldreyfd