PDB entry 1fwz

View 1fwz on RCSB PDB site
Description: glu20ala dtxr
Class: gene regulation
Keywords: metal binding protein, DNA binding protein, regulator, GENE REGULATION
Deposited on 2000-09-25, released 2001-09-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: diphtheria toxin repressor
    Species: Corynebacterium diphtheriae [TaxId:1717]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P33120
      • engineered (19)
      • modified residue (101)
    Domains in SCOPe 2.07: d1fwza1, d1fwza2, d1fwza3
  • Heterogens: SO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fwzA (A:)
    mkdlvdttemylrtiyeleaegvtplrariaerleqsgptvsqtvarmerdglvvvasdr
    slqmtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvl
    kdvsrspfgnpipgldelgvgnsdaaapgtrvidaatsmprkvrivqineifqvetdqft
    qlldadirvgseveivdrdghitlshngkdvellddlahtirieel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwzA (A:)
    lvdttemylrtiyeleaegvtplrariaerleqsgptvsqtvarmerdglvvvasdrslq
    mtptgrtlatavmrkhrlaerlltdiigldinkvhdeacrwehvmsdeverrlvkvlkdv
    srspfgnpipgldelgvpgtrvidaatsmprkvrivqineifqvetdqftqlldadirvg
    seveivdrhitlshngkdvellddlahtiri