PDB entry 1fwy

View 1fwy on RCSB PDB site
Description: crystal structure of n-acetylglucosamine 1-phosphate uridyltransferase bound to udp-glcnac
Deposited on 2000-09-25, released 2000-10-18
The last revision prior to the SCOP 1.71 freeze date was dated 2000-10-18, with a file datestamp of 2000-10-18.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: -1.68 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fwyA (A:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwyA (A:)
    nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
    kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
    qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
    wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
    qaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsv
    igddceispytvvedanlaaactigp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fwyB (B:)
    mlnnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggd
    llkqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrda
    kpqggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadm
    krwlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyq
    seqaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcvikn
    svigddceispytvvedanlaaactigpfar
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwyB (B:)
    nnamsvvilaagkgtrmysdlpkvlhtlagkamvqhvidaanelgaahvhlvyghggdll
    kqalkddnlnwvlqaeqlgtghamqqaapffaddedilmlygdvplisvetlqrlrdakp
    qggiglltvklddptgygritrengkvtgivehkdatdeqrqiqeintgiliangadmkr
    wlakltnnnaqgeyyitdiialayqegreivavhpqrlsevegvnnrlqlsrlervyqse
    qaeklllagvmlrdparfdlrgtlthgrdveidtnviiegnvtlghrvkigtgcviknsv
    igddceispytvvedanlaaacti