PDB entry 1fwx

View 1fwx on RCSB PDB site
Description: crystal structure of nitrous oxide reductase from p. denitrificans
Deposited on 2000-09-25, released 2001-09-25
The last revision prior to the SCOP 1.57 freeze date was dated 2001-09-25, with a file datestamp of 2001-09-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.241
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fwxA (A:)
    adgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrih
    ertmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvm
    kcdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavda
    dkwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeie
    kaiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvt
    vldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwnieda
    irayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpe
    ndqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadg
    vdidnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftm
    gnygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fwxB (B:)
    dgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrihe
    rtmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmk
    cdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdad
    kwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeiek
    aiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtv
    ldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedai
    rayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpen
    dqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadgv
    didnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftmg
    nygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvep
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fwxC (C:)
    dgsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvrihe
    rtmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmk
    cdaileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdad
    kwevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeiek
    aiaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtv
    ldvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedai
    rayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpen
    dqlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadgv
    didnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftmg
    nygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvepk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fwxD (D:)
    gsvapgqlddyygfwssgqsgemrilgipsmrelmrvpvfnrcsatgwgqtnesvriher
    tmsertkkflaangkrihdngdlhhvhmsftegkydgrflfmndkantrvarvrcdvmkc
    daileipnakgihglrpqkwprsnyvfcngedetplvndgtnmedvanyvnvftavdadk
    wevawqvlvsgnldncdadyegkwafstsynsekgmtlpemtaaemdhivvfniaeieka
    iaagdyqelngvkvvdgrkeasslftryipiannphgcnmapdkkhlcvagklsptvtvl
    dvtrfdavfyenadprsavvaepelglgplhtafdgrgnaytslfldsqvvkwniedair
    ayagekvdpikdkldvhyqpghlktvmgetldatndwlvclskfskdrflnvgplkpend
    qlidisgdkmvlvhdgptfaephdaiavhpsilsdiksvwdrndpmwaetraqaeadgvd
    idnwteevirdgnkvrvymssvapsfsiesftvkegdevtvivtnldeiddlthgftmgn
    ygvameigpqmtssvtfvaanpgvywyycqwfchalhmemrgrmlvep