PDB entry 1fwv

View 1fwv on RCSB PDB site
Description: crystal structure of the cysteine-rich domain of mannose receptor complexed with 3-so4-lewis(a)
Class: sugar binding protein
Keywords: beta trefoil, mannose receptor, sulfated carbohydrate, SUGAR BINDING PROTEIN
Deposited on 2000-09-24, released 2001-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cysteine-rich domain of mannose receptor
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • PIR A48925 (0-133)
  Domains in SCOPe 2.08: d1fwva_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fwvA (A:)
  darqfliynedhkrcvdalsaisvqtatcnpeaesqkfrwvsdsqimsvafklclgvpsk
  tdwasvtlyacdskseyqkweckndtlfgikgtelyfnygnrqekniklykgsglwsrwk
  vygttddlcsrgye