PDB entry 1fwc

View 1fwc on RCSB PDB site
Description: klebsiella aerogenes urease, c319a variant at ph 8.5
Class: hydrolase
Keywords: hydrolase(urea amido), mutant, nickel metalloenzyme, hydrolase
Deposited on 1997-04-23, released 1997-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fwca_
  • Chain 'B':
    Compound: urease
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fwcb_
  • Chain 'C':
    Compound: urease
    Species: Klebsiella aerogenes [TaxId:28451]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18314 (Start-566)
      • modified residue (216)
      • engineered (318)
    Domains in SCOPe 2.06: d1fwcc1, d1fwcc2
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fwcA (A:)
    meltprekdklllftaalvaerrlarglklnypesvalisafimegardgksvaslmeeg
    rhvltreqvmegvpemipdiqveatfpdgsklvtvhnpii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fwcB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgplevnde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwcB (B:)
    mipgeyhvkpgqialntgratcrvvvenhgdrpiqvgshyhfaevnpalkfdrqqaagyr
    lnipagtavrfepgqkrevelvafaghravfgfrgevmgpl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1fwcC (C:)
    msnisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqm
    laadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaatevia
    aegkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrm
    lqaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademd
    iqvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnp
    tlpytlntidehldmlmvahhldpdiaedvafaesrirretiaaedvlhdlgafsltssd
    sqamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahe
    vgsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgal
    gsarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqt
    yevrvdgelitsepadvlpmaqryflf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fwcC (C:)
    snisrqayadmfgptvgdkvrladtelwieveddlttygeevkfgggkvirdgmgqgqml
    aadcvdlvltnalivdhwgivkadigvkdgrifaigkagnpdiqpnvtipigaateviaa
    egkivtaggidthihwicpqqaeealvsgvttmvgggtgpaagthattctpgpwyisrml
    qaadslpvnigllgkgnvsqpdalreqvaagviglkihedwgatpaaidcaltvademdi
    qvalhsdtlnesgfvedtlaaiggrtihtfhtegaggghapdiitacahpnilpsstnpt
    lpytlntidehldmlmvahhldpdiaedvafaesrirretiaaedvlhdlgafsltssds
    qamgrvgevilrtwqvahrmkvqrgalaeetgdndnfrvkryiakytinpalthgiahev
    gsievgkladlvvwspaffgvkpatvikggmiaiapmgdinasiptpqpvhyrpmfgalg
    sarhhcrltflsqaaaangvaerlnlrsaiavvkgcrtvqkadmvhnslqpnitvdaqty
    evrvdgelitsepadvlpmaqryflf