PDB entry 1fw8

View 1fw8 on RCSB PDB site
Description: circularly permuted phosphoglycerate kinase from yeast: pgk p72
Class: transferase
Keywords: phosphotransferase, kinase, phosphoglycerate kinase, glycolysis, mutant, permutation, permuted sequence, PGK, protein folding, two-domain protein, TRANSFERASE
Deposited on 2000-09-22, released 2001-03-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.211
AEROSPACI score: -3.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate kinase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00560 (360-414)
      • see remark 999 (0)
    Domains in SCOPe 2.01: d1fw8a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fw8A (A:)
    skyslapvakelqsllgkdvtflndcvgpeveaavkasapgsvillenlryhieeegsrk
    vdgqkvkaskedvqkfrhelssladvyindafgtahrahssmvgfdlpqraagfllekel
    kyfgkalenptrpflailggakvadkiqlidnlldkvdsiiigggmaftfkkvlenteig
    dsifdkagaeivpklmekakakgvevvlpvdfiiadafsadantktvtdkegipagwqgl
    dngpesrklfaatvakaktivwngppgvfefekfaagtkalldevvkssaagntviiggg
    dtatvakkygvtdkishvstgggaslellegkelpgvaflsekkslssklsvqdldlkdk
    rvfirvdfnvpldgkkitsnqrivaalptikyvlehhpryvvlashlgrpngern