PDB entry 1fw6

View 1fw6 on RCSB PDB site
Description: crystal structure of a taq muts-DNA-ADP ternary complex
Class: replication/DNA
Keywords: protein-DNA complex, multi-domain structure, kinked DNA, ABC ATPase, REPLICATION/DNA COMPLEX
Deposited on 2000-09-21, released 2001-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.218
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA mismatch repair protein muts
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56215
      • modified residue (0)
      • modified residue (3)
      • modified residue (69)
      • modified residue (87)
      • modified residue (200)
      • modified residue (249)
      • modified residue (480)
      • modified residue (573)
      • modified residue (585)
      • modified residue (639)
      • modified residue (642)
      • modified residue (743)
      • modified residue (761)
    Domains in SCOPe 2.07: d1fw6a1, d1fw6a2, d1fw6a3, d1fw6a4
  • Chain 'B':
    Compound: DNA mismatch repair protein muts
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q56215 (0-End)
      • modified residue (0)
      • modified residue (3)
      • modified residue (69)
      • modified residue (87)
      • modified residue (200)
      • modified residue (249)
      • modified residue (480)
      • modified residue (573)
      • modified residue (585)
      • modified residue (639)
      • modified residue (642)
      • modified residue (743)
      • modified residue (761)
    Domains in SCOPe 2.07: d1fw6b1, d1fw6b2, d1fw6b3, d1fw6b4
  • Chain 'C':
    Compound: 5'-d(*gp*cp*gp*ap*cp*gp*cp*tp*ap*gp*cp*gp*tp*gp*cp*gp*gp*cp*tp*cp*gp*tp*c)-3'
  • Chain 'D':
    Compound: 5'-d(*gp*gp*ap*cp*gp*ap*gp*cp*cp*gp*cp*cp*gp*cp*tp*ap*gp*cp*gp*tp*cp*g)-3'
  • Heterogens: MG, SO4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fw6A (A:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvl
    ldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeag
    glvfyhqvlpgpasksygvevaamaglpkevvararallqamaarreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fw6A (A:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgr
    gtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyh
    qvlpgpasksygvevaamaglpkevvararallqamaar
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fw6B (B:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepaeeaeglvrrevtqlltpgt
    llqesllpreanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevll
    apellengafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqp
    frfydpgafmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrg
    plearldrvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilp
    elrallgeevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregva
    yfleleererertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpe
    mkekerevyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavry
    gyvrprfgdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtalia
    llaqvgsfvpaeeahlplfdgiytrigasddlaggkstfmvemeevalilkeatenslvl
    ldevgrgtssldgvaiatavaealherraytlfathyfeltalglprlknlhvaareeag
    glvfyhqvlpgpasksygvevaamaglpkevvararallqamaarreg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fw6B (B:)
    megmlkgegpgplppllqqyvelrdqypdylllfqvgdfyecfgedaerlaralglvlth
    ktskdfttpmagiplrafeayaerllkmgfrlavadqvepvrrevtqlltpgtllqesll
    preanylaaiatgdgwglafldvstgefkgtvlksksalydelfrhrpaevllapellen
    gafldefrkrfpvmlseapfepegegplalrrargallayaqrtqggalslqpfrfydpg
    afmrlpeatlralevfeplrgqdtlfsvldetrtapgrrllqswlrhplldrgplearld
    rvegfvregalregvrrllyrladlerlatrlelgraspkdlgalrrslqilpelrallg
    eevglpdlsplkeeleaalvedpplkvseggliregydpdldalraahregvayflelee
    rerertgiptlkvgynavfgyylevtrpyyervpkeyrpvqtlkdrqrytlpemkekere
    vyrlealirrreeevflevrerakrqaealreaarilaeldvyaalaevavrygyvrprf
    gdrlqiragrhpvverrtefvpndlemahelvlitgpnmagkstflrqtaliallaqvgs
    fvpaeeahlplfdgiytrigagkstfmvemeevalilkeatenslvlldevgrgtssldg
    vaiatavaealherraytlfathyfeltalglprlknlhvaareeagglvfyhqvlpgpa
    sksygvevaamaglpkevvararallqam
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.