PDB entry 1fw1

View 1fw1 on RCSB PDB site
Description: Glutathione transferase zeta/maleylacetoacetate isomerase
Class: isomerase/transferase
Keywords: glutathione transferase, ISOMERASE-TRANSFERASE COMPLEX
Deposited on 2000-09-20, released 2001-09-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.234
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase zeta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1fw1a1, d1fw1a2
  • Heterogens: SO4, DTT, GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fw1A (A:)
    mqagkpilysyfrsscswrvrialalkgidyktvpinlikdggqqfskdfqalnpmkqvp
    tlkidgitihqslaiieyleetrptprllpqdpkkrasvrmisdliaggiqplqnlsvlk
    qvgeemqltwaqnaitcgfnaleqilqstagiycvgdevtmadlclvpqvanaerfkvdl
    tpyptissinkrllvleafqvshpcrqpdtptelra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fw1A (A:)
    kpilysyfrsscswrvrialalkgidyktvpinlikdggqqfskdfqalnpmkqvptlki
    dgitihqslaiieyleetrptprllpqdpkkrasvrmisdliaggiqplqnlsvlkqvge
    emqltwaqnaitcgfnaleqilqstagiycvgdevtmadlclvpqvanaerfkvdltpyp
    tissinkrllvleafqvshpcrqpdtpt