PDB entry 1fvy

View 1fvy on RCSB PDB site
Description: solution structure of the osteogenic 1-31 fragment of the human parathyroid hormone
Class: hormone/growth factor
Keywords: helix-turn-helix, parathyroid hormone,
Deposited on 2000-09-20, released 2000-11-22
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: parathyroid hormone
  Species: HOMO SAPIENS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01270 (0-30)
  Domains in SCOP 1.75: d1fvya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fvyA (A:)
  svseiqlmhnlgkhlnsmervewlrkklqdv