PDB entry 1fvs

View 1fvs on RCSB PDB site
Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(I) load states
Class: hydrolase
Keywords: Cu(I)-Ccc2a, babbab, HYDROLASE
Deposited on 2000-09-20, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: copper-transporting ATPase
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38995 (0-71)
    • expression tag (0)
  Domains in SCOPe 2.07: d1fvsa1, d1fvsa2
• Heterogens: CU

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fvsA (A:)
  arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
  dcgfdceilrds