PDB entry 1fvs

View 1fvs on RCSB PDB site
Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(I) load states
Class: hydrolase
Keywords: Cu(I)-Ccc2a, babbab, HYDROLASE
Deposited on 2000-09-20, released 2001-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper-transporting ATPase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P38995 (0-71)
      • expression tag (0)
    Domains in SCOPe 2.08: d1fvsa1, d1fvsa2
  • Heterogens: CU

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvsA (A:)
    arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
    dcgfdceilrds