PDB entry 1fvq

View 1fvq on RCSB PDB site
Description: solution structure of the yeast copper transporter domain ccc2a in the apo and cu(i) loaded states
Deposited on 2000-09-20, released 2001-03-14
The last revision prior to the SCOP 1.57 freeze date was dated 2001-03-14, with a file datestamp of 2001-03-14.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.1 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.57: d1fvqa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fvqA (A:)
  arevilavhgmtcsactntintqlralkgvtkcdislvtnecqvtydnevtadsikeiie
  dcgfdceilrds