PDB entry 1fvk

View 1fvk on RCSB PDB site
Description: the 1.7 angstrom structure of wild type disulfide bond formation protein (dsba)
Class: disulfide oxidoreductase
Keywords: protein disulfide isomerase, protein folding, redox protein, redox-active center, disulfide oxidoreductase
Deposited on 1996-08-28, released 1997-08-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.198
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: disulfide bond formation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fvka_
  • Chain 'B':
    Compound: disulfide bond formation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1fvkb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fvkA (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fvkA (A:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fvkB (B:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fvkB (B:)
    aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek