PDB entry 1fvj

View 1fvj on RCSB PDB site
Description: the 2.06 angstrom structure of the h32y mutant of the disulfide bond formation protein (dsba)
Class: disulfide oxidoreductase
Keywords: protein disulfide isomerase, protein folding, redox protein disulfide oxidoreductase
Deposited on 1996-08-28, released 1997-05-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: 0.18
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: disulfide bond formation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991 (0-End)
      • engineered (31)
    Domains in SCOPe 2.06: d1fvja_
  • Chain 'B':
    Compound: disulfide bond formation protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24991 (0-End)
      • engineered (31)
    Domains in SCOPe 2.06: d1fvjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fvjA (A:)
    aqyedgkqyttlekpvagapqvleffsffcpycyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fvjA (A:)
    aqyedgkqyttlekpvagapqvleffsffcpycyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fvjB (B:)
    aqyedgkqyttlekpvagapqvleffsffcpycyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsekk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fvjB (B:)
    aqyedgkqyttlekpvagapqvleffsffcpycyqfeevlhisdnvkkklpegvkmtkyh
    vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
    eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
    tvkylsek