PDB entry 1fvg

View 1fvg on RCSB PDB site
Description: crystal structure of bovine peptide methionine sulfoxide reductase
Deposited on 2000-09-19, released 2000-11-08
The last revision prior to the SCOP 1.55 freeze date was dated 2000-11-15, with a file datestamp of 2000-11-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1fvga_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fvgA (A:)
kivspqealpgrkeplvvaakhhvngnrtvepfpegtqmavfgmgcfwgaerkfwtlkgv
ystqvgfaggytpnptykevcsgktghaevvrvvfqpehisfeellkvfwenhdptqgmr
qgndhgsqyrsaiyptsaehvgaalkskedyqkvlsehgfglittdiregqtfyyaedyh
qqylskdpdgyc