PDB entry 1fvd

View 1fvd on RCSB PDB site
Description: x-ray structures of the antigen-binding domains from three variants of humanized anti-p185-her2 antibody 4d5 and comparison with molecular modeling
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-10-20, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: igg1-kappa 4d5 fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA65061 (3-213)
      • conflict (13)
      • conflict (27-33)
      • conflict (49)
      • conflict (52)
      • conflict (54)
      • conflict (65)
      • conflict (90-92)
      • conflict (95)
      • conflict (102-103)
    Domains in SCOPe 2.07: d1fvda1, d1fvda2
  • Chain 'B':
    Compound: igg1-kappa 4d5 fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA75030 (1-222)
      • conflict (27-33)
      • conflict (42)
      • conflict (45)
      • conflict (48)
      • conflict (51)
      • conflict (53-56)
      • conflict (58)
      • conflict (62)
      • conflict (71)
      • conflict (73-74)
      • conflict (84)
      • conflict (96)
      • insertion (98-99)
      • conflict (101-102)
      • conflict (104-105)
      • conflict (108)
    Domains in SCOPe 2.07: d1fvdb1, d1fvdb2
  • Chain 'C':
    Compound: igg1-kappa 4d5 fab (light chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA65061 (3-213)
      • conflict (13)
      • conflict (27-33)
      • conflict (49)
      • conflict (52)
      • conflict (54)
      • conflict (65)
      • conflict (90-92)
      • conflict (95)
      • conflict (102-103)
    Domains in SCOPe 2.07: d1fvdc1, d1fvdc2
  • Chain 'D':
    Compound: igg1-kappa 4d5 fab (heavy chain)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • EMBL CAA75030 (1-222)
      • conflict (27-33)
      • conflict (42)
      • conflict (45)
      • conflict (48)
      • conflict (51)
      • conflict (53-56)
      • conflict (58)
      • conflict (62)
      • conflict (71)
      • conflict (73-74)
      • conflict (84)
      • conflict (96)
      • insertion (98-99)
      • conflict (101-102)
      • conflict (104-105)
      • conflict (108)
    Domains in SCOPe 2.07: d1fvdd1, d1fvdd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdA (A:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdB (B:)
    evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry
    adsvkgrftisadtskntlylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdC (C:)
    diqmtqspsslsasvgdrvtitcrasqdvntavawyqqkpgkapklliysasflesgvps
    rfsgsrsgtdftltisslqpedfatyycqqhyttpptfgqgtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fvdD (D:)
    evqlvesggglvqpggslrlscaasgfnikdtyihwvrqapgkglewvariyptngytry
    adsvkgrftisadtskntlylqmnslraedtavyycsrwggdgfyamdvwgqgtlvtvss
    astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc