PDB entry 1fv5

View 1fv5 on RCSB PDB site
Description: solution structure of the first zinc finger from the drosophila u-shaped transcription factor
Class: transcription
Keywords: zinc finger, cchc, protein interaction, transcription
Deposited on 2000-09-18, released 2000-10-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: first zinc finger of u-shaped
  Species: Drosophila melanogaster [TaxId:7227]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9VPQ6 (2-35)
    • cloning artifact (0-1)
  Domains in SCOPe 2.06: d1fv5a1, d1fv5a2
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1fv5A (A:)
  gsllkparfmclpcgiafsspstleahqayycshri