PDB entry 1fv3

View 1fv3 on RCSB PDB site
Description: the hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor gt1b
Class: toxin
Keywords: toxin, carbohydrate, ganglioside, multi-valent binding, receptor
Deposited on 2000-09-18, released 2001-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetanus toxin heavy chain
    Species: Clostridium tetani [TaxId:1513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fv3a1, d1fv3a2
  • Chain 'B':
    Compound: tetanus toxin heavy chain
    Species: Clostridium tetani [TaxId:1513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1fv3b1, d1fv3b2
  • Heterogens: PO4, CEQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fv3A (A:)
    mgsshhhhhhssglvprgshmknldcwvdneedidvilkkstilnldinndiisdisgfn
    ssvitypdaqlvpgingkaihlvnnessevivhkamdieyndmfnnftvsfwlrvpkvsa
    shleqygtneysiissmkkhslsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkf
    naylankwvfititndrlssanlyingvlmgsaeitglgairednnitlkldrcnnnnqy
    vsidkfrifckalnpkeieklytsylsitflrdfwgnplrydteyylipvassskdvqlk
    nitdymyltnapsytngklniyyrrlynglkfiikrytpnneidsfvksgdfiklyvsyn
    nnehivgypkdgnafnnldrilrvgynapgiplykkmeavklrdlktysvqlklyddkna
    slglvgthngqigndpnrdiliasnwyfnhlkdkilgcdwyfvptdegwtnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fv3A (A:)
    knldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaih
    lvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhs
    lsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssa
    nlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekl
    ytsylsitflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklni
    yyrrlynglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldri
    lrvgynapgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdil
    iasnwyfnhlkdkilgcdwyfvptdegwtnd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fv3B (B:)
    mgsshhhhhhssglvprgshmknldcwvdneedidvilkkstilnldinndiisdisgfn
    ssvitypdaqlvpgingkaihlvnnessevivhkamdieyndmfnnftvsfwlrvpkvsa
    shleqygtneysiissmkkhslsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkf
    naylankwvfititndrlssanlyingvlmgsaeitglgairednnitlkldrcnnnnqy
    vsidkfrifckalnpkeieklytsylsitflrdfwgnplrydteyylipvassskdvqlk
    nitdymyltnapsytngklniyyrrlynglkfiikrytpnneidsfvksgdfiklyvsyn
    nnehivgypkdgnafnnldrilrvgynapgiplykkmeavklrdlktysvqlklyddkna
    slglvgthngqigndpnrdiliasnwyfnhlkdkilgcdwyfvptdegwtnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fv3B (B:)
    knldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaih
    lvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhs
    lsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssa
    nlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekl
    ytsylsitflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklni
    yyrrlynglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldri
    lrvgynapgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdil
    iasnwyfnhlkdkilgcdwyfvptdegwtnd