PDB entry 1fv2

View 1fv2 on RCSB PDB site
Description: The Hc fragment of tetanus toxin complexed with an analogue of its ganglioside receptor GT1B
Class: toxin
Keywords: toxin, carbohydrate, ganglioside, multi-valent binding, receptor
Deposited on 2000-09-18, released 2001-09-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.225
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tetanus toxin heavy chain
    Species: Clostridium tetani [TaxId:1513]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1fv2a1, d1fv2a2
  • Heterogens: PO4, CEQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fv2A (A:)
    mgsshhhhhhssglvprgshmknldcwvdneedidvilkkstilnldinndiisdisgfn
    ssvitypdaqlvpgingkaihlvnnessevivhkamdieyndmfnnftvsfwlrvpkvsa
    shleqygtneysiissmkkhslsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkf
    naylankwvfititndrlssanlyingvlmgsaeitglgairednnitlkldrcnnnnqy
    vsidkfrifckalnpkeieklytsylsitflrdfwgnplrydteyylipvassskdvqlk
    nitdymyltnapsytngklniyyrrlynglkfiikrytpnneidsfvksgdfiklyvsyn
    nnehivgypkdgnafnnldrilrvgynapgiplykkmeavklrdlktysvqlklyddkna
    slglvgthngqigndpnrdiliasnwyfnhlkdkilgcdwyfvptdegwtnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fv2A (A:)
    knldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaih
    lvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhs
    lsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssa
    nlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiekl
    ytsylsitflrdfwgnplrydteyylipvassskdvqlknitdymyltnapsytngklni
    yyrrlynglkfiikrytpnneidsfvksgdfiklyvsynnnehivgypkdgnafnnldri
    lrvgynapgiplykkmeavklrdlktysvqlklyddknaslglvgthngqigndpnrdil
    iasnwyfnhlkdkilgcdwyfvptdegwtnd