PDB entry 1fux

View 1fux on RCSB PDB site
Description: crystal structure of e.coli ybcl, a new member of the mammalian pebp family
Class: unknown function
Keywords: beta protein, unknown function
Deposited on 2000-09-18, released 2001-07-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.2
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical 19.5 kda protein in emre-rus intergenic region
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77368 (2-163)
      • cloning artifact (1)
      • modified residue (145)
      • cloning artifact (164-165)
    Domains in SCOPe 2.06: d1fuxa1, d1fuxa2, d1fuxa3
  • Chain 'B':
    Compound: hypothetical 19.5 kda protein in emre-rus intergenic region
    Species: Escherichia coli [TaxId:562]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77368 (2-163)
      • cloning artifact (0-1)
      • modified residue (145)
    Domains in SCOPe 2.06: d1fuxb1, d1fuxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fuxA (A:)
    aefqvtsneiktgeqlttshvfsgfgceggntspsltwsgvpegtksfavtvydpdaptg
    sgwwhwtvvnipatvtylpvdagrrdgtklptgavqgrndfgyagfggacppkgdkphhy
    qfkvwalktekipvdsnssgalvgymlnankiataeitpvyeikle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuxA (A:)
    efqvtsneiktgeqlttshvfsgfgceggntspsltwsgvpegtksfavtvydpdaptgs
    gwwhwtvvnipatvtylpvdagrrdgtklptgavqgrndfgyagfggacppkgdkphhyq
    fkvwalktekipvdsnssgalvgymlnankiataeitpvyeikle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fuxB (B:)
    aefqvtsneiktgeqlttshvfsgfgceggntspsltwsgvpegtksfavtvydpdaptg
    sgwwhwtvvnipatvtylpvdagrrdgtklptgavqgrndfgyagfggacppkgdkphhy
    qfkvwalktekipvdsnssgalvgymlnankiataeitpvyeikle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuxB (B:)
    aefqvtsneiktgeqlttshvfsgfgceggntspsltwsgvpegtksfavtvydpdaptg
    sgwwhwtvvnipatvtylpvdagrrdgtklptgavqgrndfgyagfggacppkgdkphhy
    qfkvwalktekipvdsnssgalvgymlnankiataeitpvyeik