PDB entry 1fuw

View 1fuw on RCSB PDB site
Description: solution structure and backbone dynamics of a double mutant single- chain monellin(scm) determined by nuclear magnetic resonance spectroscopy
Deposited on 2000-09-18, released 2001-06-06
The last revision prior to the SCOP 1.57 freeze date was dated 2001-06-06, with a file datestamp of 2001-06-06.
Experiment type: NMR21
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1fuwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fuwA (A:)
    geweiieigpftqnlgkfavdeenkigqygrltfnkvikpcmkktiyenereikgyeyql
    yvyasdklfradisedyktrgrkllrfngpv