PDB entry 1fuw

View 1fuw on RCSB PDB site
Description: solution structure and backbone dynamics of a double mutant single-chain monellin(scm) determined by nuclear magnetic resonance spectroscopy
Class: plant protein
Keywords: beta-sheet, alpha-helix, loop, PLANT PROTEIN
Deposited on 2000-09-18, released 2001-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: monellin
    Species: Dioscoreophyllum cumminsii [TaxId:3457]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02882 (0-49)
      • engineered (6)
      • engineered (38)
      • see remark 999 (48-49)
    • Uniprot P02881 (50-90)
    Domains in SCOPe 2.08: d1fuwa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1fuwA (A:)
geweiieigpftqnlgkfavdeenkigqygrltfnkvikpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpv