PDB entry 1fuu

View 1fuu on RCSB PDB site
Description: yeast initiation factor 4a
Class: translation
Keywords: if4a, helicase, dead-box protein, translation
Deposited on 2000-09-15, released 2000-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.243
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yeast initiation factor 4a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10081
      • modified residue (25)
      • modified residue (52)
      • modified residue (93)
      • modified residue (109)
      • modified residue (115)
      • modified residue (164)
      • modified residue (173)
      • modified residue (202)
      • modified residue (214)
    Domains in SCOPe 2.07: d1fuua_
  • Chain 'B':
    Compound: yeast initiation factor 4a
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10081 (Start-393)
      • modified residue (25)
      • modified residue (52)
      • modified residue (93)
      • modified residue (109)
      • modified residue (115)
      • modified residue (164)
      • modified residue (173)
      • modified residue (202)
      • modified residue (214)
      • modified residue (301)
      • modified residue (370)
    Domains in SCOPe 2.07: d1fuub1, d1fuub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1fuuA (A:)
    segitdieesqiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghd
    vlaqaqsgtgktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikv
    haciggtsfvedaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfk
    eqiyqiftllppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnv
    eeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerdt
    imkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggrfgrkgvai
    nfvtnedvgamrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuuA (A:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
    edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
    ppttqvvllsatmpndvlevttkfmrnpvrilvkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1fuuB (B:)
    segitdieesqiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghd
    vlaqaqsgtgktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikv
    haciggtsfvedaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfk
    eqiyqiftllppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnv
    eeeeykyecltdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerdt
    imkefrsgssrilistdllargidvqqvslvinydlpankenyihrigrggrfgrkgvai
    nfvtnedvgamrelekfystqieelpsdiatlln
    

    Sequence, based on observed residues (ATOM records): (download)
    >1fuuB (B:)
    qiqtnydkvvykfddmeldenllrgvfgygfeepsaiqqraimpiieghdvlaqaqsgtg
    ktgtfsiaalqridtsvkapqalmlaptrelalqiqkvvmalafhmdikvhaciggtsfv
    edaeglrdaqivvgtpgrvfdniqrrrfrtdkikmfildeademlssgfkeqiyqiftll
    ppttqvvllsatmpndvlevttkfmrnpvrilvkkdeltlegikqfyvnveeeeykyecl
    tdlydsisvtqavifcntrrkveelttklrndkftvsaiysdlpqqerdtimkefrsgss
    rilistdllargidvqqvslvinydlpankenyihrigrggkgvainfvtnedvgamrel
    ekfystqieelpsdiatlln