PDB entry 1fus

View 1fus on RCSB PDB site
Description: crystal structures of ribonuclease f1 of fusarium moniliforme in its free form and in complex with 2'gmp
Deposited on 1993-01-18, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.3 Å
R-factor: 0.187
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1fus__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fus_ (-)
    esattcgstnysasqvraaanaacqyyqnddtagsstyphtynnyegfdfpvdgpyqefp
    iksggvytggspgadrvvintnceyagaithtgasgnnfvgcsgtn